DPCstruct | MC12362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 160 ± 32 aa |
| Standard deviation of domain lengths | 32.09 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.45 |
| Pfam Score | 99.44 |
| Assigned Pfam label(s) | CL0010- PF04065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2I961 | 521-696 | QFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLARYG… |
| A0A0W8DD00 | 345-491 | PQLTEEQKQVLRLIDESFHFIPESRDSEKANRYVPRNLYPTPASFPATPSTLFSSAPIFEKLDVDTLFFIFYYQQGSYQQYLAAREL… |
| A0A7J6Q3D4 | 415-563 | None |
| A0A1R0H0Z7 | 402-569 | None |
| A0A1B8EP07 | 728-890 | None |
| A0A1I8IPL1 | 27-152 | None |
| A0A7S3JKN1 | 1-106 | None |
| A0A1I8F8E0 | 101-232 | None |
| A0A1Q9CE26 | 332-484 | None |
| A0A444WWW9 | 12-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.