DPCstruct | MC12361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 214 ± 25 aa |
| Standard deviation of domain lengths | 24.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4B944 | 16-220 | SNNYKTFENMISHAIFCASRRNGVAGILFDNFFGWLLGELQNDLTMVEMTHDSKPIVASKLFDGYKKNMPSMMIPFLTPPNVEWPQG… |
| A0A0W8DCL9 | 8-268 | KAFASVESNTYVYSITANNAFYYPSKNMRLEMVVAGAVIIASHRNGLAGIVFADFFSSLLYELGMQSTLDQRIEFPESIQELVSSFT… |
| A0A1Y2ALD4 | 330-524 | None |
| A0A1Y2BMN6 | 606-838 | None |
| A0A833S5W2 | 46-248 | None |
| A0A833SAL8 | 622-796 | None |
| A0A0W8CB61 | 100-302 | None |
| A0A6G0S3X1 | 254-456 | None |
| A0A6G0R3P9 | 363-592 | None |
| A0A6G0W9I7 | 198-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.