DPCstruct | MC12360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 204 ± 39 aa |
| Standard deviation of domain lengths | 39.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 99.33 |
| Assigned Pfam label(s) | PF01016- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4FCL2 | 2-122 | TGAVIPELESELIAANNPDFKINLKRLRMLEKLIQENQHVHTDEAKLLLEKWLDERNALRRGSKCVFNPQFGSIFRSFHNPSYFSQR… |
| A0A0W8DBI9 | 23-204 | RQRSFRMLDIGHKQVQVYTQGSVYQLSKLTGWVGSRVLYIGDNLFSDLVEPSRANGWRTGAIIRELEDEMHVHRTPEYQRLAFQISK… |
| A0A3P8WML2 | 149-339 | None |
| A0A7N8Y0X3 | 246-464 | None |
| A0A4W4FL82 | 170-359 | None |
| A0A835XQH3 | 2-162 | None |
| A0A1W0XEM3 | 765-1011 | None |
| A0A2A4JVG1 | 794-1003 | None |
| A0A090KX30 | 4-159 | None |
| A0A540KF51 | 57-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.