DPCstruct | MC1236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 139 ± 23 aa |
| Standard deviation of domain lengths | 22.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18950 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7WQH1 | 83-266 | IGVSHWANYGQKGNDVVQTNEPDILSNQYQKELEEIASKIKKFNPDKIFVERVIDYQPKLDSLYQLYKTSNWGDNKRNEIYQLGFRI… |
| A0A1Y5I9Q7 | 38-184 | EDRVEPVQVMVLGTYHFENPGLDLVNTDADDVLAPHRQAELQDLAERLTAFRPTAIALERIRQTDDALDPNFVDFVPEDLTRKRNER… |
| A0A7U3ACA5 | 6-138 | None |
| A0A7Y5MPW9 | 313-447 | None |
| A0A4Q3RKW3 | 36-161 | None |
| A0A495Z651 | 2-92 | None |
| A0A7H0V6C1 | 2-101 | None |
| A0A7X3TC58 | 169-319 | None |
| F4L6A5 | 186-331 | None |
| A0A2E8MSE5 | 2-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.