DPCstruct | MC12357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 141 ± 25 aa |
| Standard deviation of domain lengths | 24.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2Z0S9 | 177-295 | LSQIHDLLTRRWRDSQATLALRDFYPYWFRNREDPTAGKLLVLDPTDSAEGVHAMFFDDNILPHDAHIVDARYAHNDSALSFAETRE… |
| A0A0W8D420 | 25-159 | TVQIVQGLSQIHDLLTRRWRDSQATLALRDFYPYWFRNREDPTAGKLLVLDPTDSAEGVHAMFFDDNILPHDAHIVDARYAHNDSAL… |
| B7G4B5 | 265-374 | None |
| A0A5K4F8S7 | 327-517 | None |
| A0A813FUT8 | 183-334 | None |
| A0A7S0ABU2 | 148-302 | None |
| A0A7S2JPQ4 | 27-144 | None |
| A0A7S2S4A4 | 4-91 | None |
| A0A812IZU0 | 259-435 | None |
| A0A7R9ZQ55 | 353-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.