DPCstruct | MC12356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 176 ± 21 aa |
| Standard deviation of domain lengths | 21.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I4BSG5 | 1-153 | MSQEDRLVDAVTTPGGVRLQPSREEVQNFLTAATKLDGDLLGYALLSKLQARLWQVRLKAMCIVEAVLRQGDSHDVYQRMGGIFQEN… |
| A0A0W8D144 | 1-157 | MHSQRRPAPESTYASQAARWKQGFKTPAQQQSAQHQADLENALVSELCSSVGSSSFPPREVLQKLLRYLHTLDHDYICELLDDKFES… |
| A0A0M0K7M5 | 275-461 | None |
| A0A830I390 | 7-192 | None |
| A0A7S2Q2N9 | 252-449 | None |
| A0A3F2RVA3 | 460-612 | None |
| A0A1R2AZC9 | 62-215 | None |
| A0A7S3QEK2 | 350-563 | None |
| A0A3R6WUH5 | 85-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.