DPCstruct | MC12355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 69 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644ZBH6 | 78-140 | EIIDSETLLPLPDGDTGEIVLTSLRNRAMPLIRYRTGDIGRLIAVPCACGGSLPRLGRVEGRL |
| A0A3D5WDZ8 | 108-175 | EVVDPETGKALPDGEEGEFIITALSNQTMPLIRYRPGDVGRMFPYEPCSCGRTLPRMSSVRGRVSHLI |
| A0A7C5U827 | 94-161 | None |
| A0A0W0ZG80 | 31-116 | None |
| A0A7W0YM41 | 1-74 | None |
| A0A7K4DAH1 | 4-72 | None |
| A0A662G8Q5 | 1-52 | None |
| A0A1G2ZRV8 | 129-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.