DPCstruct | MC12354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 6.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DMX2 | 1-74 | MELCSFHSCSKGYMGECGLRGGYVEVLNMHPDVFKHFKKMISAKLCPTVLGQIVMDCVANPPKPGDPSYNLWIK |
| A0A7R9BFS1 | 521-597 | LELASFMSSSKGYMGECGLRGGYAEIVNFDDDVRAMFLKSISAKLCPTVLGQATMDVVVNPPRAGEPSFELYAAEKK |
| A0A3L6DJB8 | 35-127 | None |
| A0A7S2H214 | 97-171 | None |
| A0A821VTM2 | 1-64 | None |
| A0A817RB17 | 438-514 | None |
| A0A835HK54 | 38-112 | None |
| A0A7R9KKU0 | 114-188 | None |
| A0A2N9INC1 | 789-863 | None |
| A0A166CAB1 | 3-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.