DPCstruct | MC12353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6A280 | 6-75 | SPIKIALIAILFVAYADQSTAESWAFLNPQSNCKIRCENGGVCAFQIQNPDVHKCICFVGMYFGDRCQHR |
| A0A183DL28 | 1-72 | MSIKSVLLCTVMYSITLHAQQRKAFVNPQSQCRIKCLNGGFCAYLVENPAVHTCLCLLNLFYGDRCQYAGKP |
| A0A183DS50 | 1-69 | None |
| A0A0J9YAU5 | 1-76 | None |
| A0A1I7YD53 | 1-80 | None |
| A0A0N5CXX0 | 21-92 | None |
| A0A6V7UGH1 | 1-74 | None |
| A0A0N4XH06 | 6-72 | None |
| A0A0C2BGQ1 | 1-72 | None |
| A0A6G0UXJ3 | 178-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.