DPCstruct | MC12352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 98 ± 22 aa |
| Standard deviation of domain lengths | 22.05 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8QQW2 | 435-510 | PWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLSIYDGPEQ |
| A0A183DKX4 | 7-95 | FYMLLGGREPWTFRNTVDDWLQTDSAWRSEPIEYPKSDGKVTFDILSSVALTGTNHEEDQPSHLLLRNDADAEQTSWRRFAGITERY… |
| A0A200QEC5 | 791-941 | None |
| B7PRC8 | 1-83 | None |
| K0E1H1 | 39-134 | None |
| A0A069PDA5 | 1-68 | None |
| A0A485BXX9 | 5-100 | None |
| D4D5J7 | 385-502 | None |
| A0A446JW70 | 51-151 | None |
| A0A0N5CTW1 | 19-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.