DPCstruct | MC12350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 160 ± 6 aa |
| Standard deviation of domain lengths | 5.67 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 77.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DI18 | 2-160 | RQVQTQNNKSVNEALNQVLIDEEDYAGLRASIDAYDNFDNIALAQQLEKHELLEFRRISAYLYKGNNRWKQSVELCKKDKLYKDAME… |
| A0A7S0T5V6 | 96-248 | PPEVVEALLDVYFAEEALLHLRELIDMMRDFDQLALSERLENHPNAEFRQLGVELHKRGGRHERALELAKKEKLWKDAIGVAAHSED… |
| A0A4W5P6Y9 | 266-423 | None |
| A0A2S4UMU0 | 77-229 | None |
| A0A0P0XY45 | 460-619 | None |
| A0A3L6GAD8 | 325-488 | None |
| Q10161 | 1450-1607 | None |
| A0A1I8FH54 | 543-712 | None |
| A0A446RZG1 | 153-325 | None |
| A0A811QKC7 | 237-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.