DPCstruct | MC1235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 202 ± 29 aa |
| Standard deviation of domain lengths | 29.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830HGU3 | 242-444 | TVLAGTFLWSVGKVVRHKLSPRTRRKRLVARNLGVIEKLNKYLPTRREELTPQLVRAVRSQSGFSAEEVFRKYLRYVLDQRPFDTNA… |
| A0A1Y5I941 | 28-261 | NPGLRNLGALALFFLASTLTYSCYKVYRKATSGRAKRKRTVNKNVEVVERLKNFFPNERDSLNKGVLKGISLKTGYSQSEIVRKYLR… |
| A0A4D9BQY3 | 318-501 | None |
| A0A7J7QMG8 | 126-356 | None |
| A0A2P6PNV0 | 28-287 | None |
| A0A3M7L4X2 | 138-322 | None |
| A0A7S0KL72 | 140-331 | None |
| A0A2R6WQ87 | 105-291 | None |
| M7ZF80 | 18-232 | None |
| A0A2P5VW24 | 2-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.