DPCstruct | MC12348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 73.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DGL4 | 1-64 | MTSVLMCPDGKTIEAEAAHGTVTRHYREHQKGNPTSTNPVASIFAWSRGLDHRGKLDSNDALRK |
| A0A7J6RCH3 | 51-112 | MTSVLVCPDGKTIEAEAAHGTVTRHYRQHQKGMKTSTNPIASIFAWTRGLAHRAKLDGNDEL |
| A0A446PMG2 | 38-90 | None |
| A0A5N6Q1T7 | 101-159 | None |
| A0A146H4F3 | 1015-1075 | None |
| A0A3Q8UC38 | 206-266 | None |
| A0A5N5QI75 | 1030-1090 | None |
| A0A2P5XFB6 | 325-385 | None |
| S9YG01 | 292-352 | None |
| A0A6A2XU88 | 265-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.