DPCstruct | MC12347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.92 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07780 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3PN43 | 651-743 | KVEAAKRKATSVADAPDMSARSKMRAIAKIYKGTEVKKPNSVYVVAKKSSKGQVSVKGSRQKGAKVKLVDKRLRADQSRGNKKRSKG… |
| A0A317BJ80 | 385-474 | AQRLEKLKKKSALLADEEGMTEKEKAQSIARLMSRAAKKKPKQKVSVIVAKGGNKGIKNRPKGTKGKYKMVDARLKKDVRGEKRAAK… |
| A0A7S3KIT5 | 299-397 | None |
| A0A7R9JLC2 | 37-147 | None |
| A0A7S0BF78 | 479-576 | None |
| A0A830HG72 | 847-952 | None |
| A0A2K0TSB5 | 86-174 | None |
| A0A1Q9CNT9 | 215-302 | None |
| A0A4W5KWP7 | 8-105 | None |
| A0A3L6VC14 | 25-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.