DPCstruct | MC12345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 199 ± 35 aa |
| Standard deviation of domain lengths | 35.29 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9EE75 | 25-231 | DSTLYIVSHTGAVRCDANLDEKFSVTLKEAISRVQNENIRQIVILIASSDSYPLFFYYNMFRKEEIRSQRNIDLAHLPKLGLHRIKE… |
| A0A183DD94 | 29-218 | YIVSRTGEVRCVPNLEEKFSIMLKEAVSRVQNENIRQMVILIASSDSYPMFFYYDMICKEEIRSQRNIDLAHLPKLGLHRIKGNYNI… |
| A0A2T6Z9N3 | 147-318 | None |
| A0A1S3J5V5 | 2-184 | None |
| A0A2T6ZEI7 | 629-788 | None |
| A0A2T6ZQT5 | 434-656 | None |
| A0A0U0WC58 | 164-366 | None |
| A0A1M3CUQ1 | 325-524 | None |
| A0A0C9VFA2 | 212-406 | None |
| Q13085 | 1288-1501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.