DPCstruct | MC12343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 52.20 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0023- PF02889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183JFZ7 | 289-377 | TPQILNFTIPLYEPYPTQYFVRILSDCWLGTDSTCPISLKRLILPSSDPPHTDLLKLQPLPVTALKNANYELLYNFPYFNPIQTQLF… |
| A0A822GLS7 | 82-177 | KQVVTKEQQFLVFTIPIFEPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPVSALGHREYEMLYKFTHFNP… |
| A0A0P0VUP0 | 107-188 | None |
| E4YRB2 | 142-221 | None |
| A0A813KE17 | 2-91 | None |
| A0A226MFP0 | 188-266 | None |
| U6KM92 | 186-276 | None |
| U6KAI7 | 407-497 | None |
| A8JJC3 | 212-308 | None |
| A0A820FEH8 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.