DPCstruct | MC12342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 205 ± 21 aa |
| Standard deviation of domain lengths | 20.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10312 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DBE2 | 8-197 | ASDEARYTNTNNPFNDPNLTSTFVWTKKLASEGKANLSISEIEKMNRERIRKNLTEMEELKRNREARDAAREDLEMIKRDEERRQNW… |
| A0A453M412 | 5-179 | AVSGYSNDSNPFGDPNLTENFVWRKKIDRAVTEGQKVDISVKAEKKRQRERMAEIEKVKKRREERAIEKAQHEEEMALLARERARAE… |
| A0A060SPG6 | 8-230 | None |
| A0A067CLR8 | 41-280 | None |
| A0A1V9ZIY3 | 39-267 | None |
| A0A200R9P6 | 647-864 | None |
| A0A0F7SYR0 | 140-349 | None |
| A0A7J6VM91 | 102-295 | None |
| A0A803LBB4 | 13-179 | None |
| A0A0V0XYL7 | 115-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.