DPCstruct | MC12341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 141 ± 11 aa |
| Standard deviation of domain lengths | 10.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8AGQ0 | 117-264 | EEVKKLAKLRETDRNSFYQQEEKIRTLEAEIEKWKLDYVLLIQSSIRFPTGDSVEDAELILFGGDRHKIRIKRLLEEARRINPGLPT… |
| A0A183DAS7 | 1-129 | LAKDLNNFKREYVFLLQNCIKIPFNDQQPVDILQVKLLGGSVHKKRVIRLLEEARAIDPTLPTFESVTTLGNHLDVFGFRRSFDDED… |
| A0A3P6IDN9 | 4-129 | None |
| A0A8B6E268 | 391-539 | None |
| A0A564Y9M1 | 231-377 | None |
| B7PQG8 | 162-316 | None |
| A0A3P7GEX1 | 2-129 | None |
| A0A1I8HMZ1 | 86-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.