DPCstruct | MC12337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 65 ± 2 aa |
| Standard deviation of domain lengths | 1.84 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 61.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9EE86 | 45-111 | LMKLNPLVSLLSLYDIAGTPGVAADVSHINSPALVKGFMGEDQLGEALEGSDVVIIPAGVPRKPGMT |
| A0A183D5G8 | 2-65 | LLKLNSNIRKLALYDIKGTPGVGADISHIDSVAQVTAHNGPNELGAALEGTDIVVISAGVPRKP |
| A0A0R3UJ44 | 2-67 | None |
| A0A5J5ULR3 | 1-65 | None |
| A0A7J9IUC9 | 45-105 | None |
| A0A835S3M5 | 55-118 | None |
| A0A183UMF5 | 47-113 | None |
| K3XL70 | 45-111 | None |
| A0A485K982 | 37-100 | None |
| A0A6S8SW27 | 61-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.