DPCstruct | MC12334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 133 ± 20 aa |
| Standard deviation of domain lengths | 19.81 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6LVG5 | 1-94 | MRYEPFRMARTEELSEIAHRRAIAAVDWVDSLTEIAEVPETEDKVALVKSCYSPLTIFNFSARTAQNTPNPDILCLCSHSYVPRRLP… |
| A0A183D369 | 1-136 | MSSMGHPSNTSPIGIARIKVDPDPDLSGIFQNKYVLGADRFDMCYQVDRTVTVEKLSEAIRRYIAAAVDWIDALFSLVNITDCSEKV… |
| A0A183EC30 | 43-191 | None |
| A0A2A2KXD9 | 103-249 | None |
| A0A2G9T928 | 1-94 | None |
| A0A0D8XCA8 | 3-145 | None |
| A0A0C2CU02 | 82-224 | None |
| A0A0C2CM47 | 1-134 | None |
| A0A6A5GNP6 | 6-149 | None |
| A0A3P7LM67 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.