DPCstruct | MC12333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 101 ± 6 aa |
| Standard deviation of domain lengths | 6.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7Z3U8 | 134-233 | PLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMRNSQVRLPLGTLSKSEWE… |
| A0A183D2Z7 | 2-105 | LSDCGMELVYKKRFPDAFDYYLGERNGQGLLQRMQALETYPPVDGAKLMGSPDSYEIPEKKRAKILVGRPDEGCGAVGTLSKGEWEV… |
| A0A4Y7LS91 | 391-491 | None |
| A0A158QPJ3 | 82-184 | None |
| J9B5S6 | 105-211 | None |
| A0A2A2KPR8 | 156-267 | None |
| A0A212C6Q7 | 21-121 | None |
| H2YL79 | 52-159 | None |
| A0A0D6LTF9 | 12-106 | None |
| B0XI05 | 37-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.