DPCstruct | MC12332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 201 ± 35 aa |
| Standard deviation of domain lengths | 35.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.15 |
| Pfam Score | 84.65 |
| Assigned Pfam label(s) | CL0063- PF12769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2GWL7 | 504-734 | VTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLALMGGHLYPSTTSQGLAALATFISSVNIAGGFLVTQRMLDMFKRP… |
| A0A183D2P4 | 2-220 | LTTFGLAGIVGYHTVWEVVPALHSPLMSVTNAISGITAAAAVCVMGGGLYPTNSAQALAAAATFFSAINIGGGFLITKRMLDMFWRP… |
| A0A813HF93 | 107-296 | None |
| A0A4P9W062 | 81-224 | None |
| A0A0G1DTI7 | 9-212 | None |
| A0A835XZX3 | 479-735 | None |
| A0A7M3RW15 | 165-347 | None |
| H0EC75 | 197-420 | None |
| A0A0L7KV01 | 151-400 | None |
| J4U7B8 | 455-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.