DPCstruct | MC12331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 14.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183D243 | 7-121 | PKLLTSSKDLMISGFFVQWVMCTAIFTVGMIINAYEGFPKFYPLAMLGGMSWTIGNATAIPILRVIGLGMGVLLWGITNCLMGWASS… |
| A0A3P7EZ38 | 4-105 | GLFTQWVMGAAIFVIGMIVNAYEGFPTFHPLAMLGGALWATGNVTAVPILSMIGMGMGILVWGTVNCLCGWAAGRFGLFGLHPSVPN… |
| A0A0B1T4C2 | 2-131 | None |
| A0A3P7EQH4 | 1-136 | None |
| A0A2G9TT86 | 117-245 | None |
| A0A0M3KC25 | 2-112 | None |
| A0A0M3KAT6 | 1-97 | None |
| A0A498SCT6 | 1-141 | None |
| A0A813VU67 | 11-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.