DPCstruct | MC1233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 342 ± 40 aa |
| Standard deviation of domain lengths | 39.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 65.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.30 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0123- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6MAV9 | 89-411 | KTTSTEHVQPPGQPAAKRRKRSRASNKNSTDEFSQIRKRVRYILNRMNYEQSLIEAYASEGWKNQSLDKIRPEKELERAKSEILRCK… |
| A0A096PAQ1 | 1-389 | MNEFALARSRIQSQFATIRRHQALVEAYASDGWRGQAAQKPKPVREIEKAREKIFEGKLKIREYFKVLEFDEREREITTVADEFGEC… |
| A0A287TJP5 | 3-398 | None |
| A0A061SH24 | 1-294 | None |
| A0A485K5R0 | 232-585 | None |
| A0A061QU89 | 1-378 | None |
| A0A150GJA1 | 2-268 | None |
| A0A446W5G5 | 74-393 | None |
| A0A1V9ZL71 | 2-360 | None |
| A0A438EPI9 | 179-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.