DPCstruct | MC12328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 146 ± 20 aa |
| Standard deviation of domain lengths | 19.62 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182T0C9 | 28-165 | PHTKFEAFVDDLTADEVLEQVQSAALNARTKLLKRKSAHKLGFLRQHKDGTTSMKILLDTKSEGGEGGPERTVTLGAHTGKLQYGTG… |
| A0A0B1RRR0 | 1-112 | MTPDDCLRAADPAARPRLSTRLPNAKLAFLDNKDGATVLNVIGETEKKGIKLGDIVGPLEEGTPGMLSLGDHRLSGQSMITYLNYGP… |
| A0A177AVB9 | 141-256 | None |
| T1KJ57 | 79-248 | None |
| E9FUK4 | 115-268 | None |
| A0A183HI99 | 1-153 | None |
| A0A1A8MMA9 | 174-344 | None |
| A0A1I7UJJ3 | 170-320 | None |
| A0A2S2QMA4 | 103-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.