DPCstruct | MC12327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 229 ± 16 aa |
| Standard deviation of domain lengths | 15.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6NE01 | 72-295 | MNQRLIICSNEGIHEFDYVTPRDALREALFDGGAEGRATVQLWQQFGATEVLVLALSVLTSELAVDERIKEKAASMFYSFKDTPELV… |
| A0A183CZB8 | 1-258 | MDLPFMRDVREKFIVLCEKGMQTIEQRTPLDMLREILRHYGPDSAQVSYLSHLHGQVNVCEMALTILCVDIGASTALKDSALRLFFM… |
| A0A060X8C5 | 4-244 | None |
| A0A0A9D7L2 | 1-208 | None |
| A0A183HD59 | 1-219 | None |
| A0A673MGZ5 | 501-742 | None |
| A0A315AX95 | 180-400 | None |
| A0A7R9IC58 | 437-675 | None |
| A0A3R7MHP5 | 123-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.