DPCstruct | MC12326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 122 ± 22 aa |
| Standard deviation of domain lengths | 22.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B5LXM4 | 186-295 | TPLTPLCTQPEQVIKGGASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKGEDLGKVEFDEEIKKRFKMVYVPNWFSVDLKTGMLT… |
| A0A183CYR0 | 3-112 | PCVYEPDVIIPGAASIRQHVVLNDKRHIITKDTDDNVAMWDVLKGKKVSDHGKRPMEEVIKDNFKKVFVPSWFTVDLKSGMLQITLD… |
| A0A7J6YN10 | 246-390 | None |
| Q54ZP5 | 795-908 | None |
| A0A2K3NPK6 | 86-193 | None |
| A0A0N0P9P5 | 335-441 | None |
| A0A183P6U8 | 173-318 | None |
| A0A5K4FBG4 | 20-164 | None |
| A0A0C3TEY2 | 292-396 | None |
| A0A2H2IT98 | 348-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.