DPCstruct | MC12325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 2.85 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 65.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4YNP3 | 277-348 | DDHMIVFFAEEDDKEGKQFLKLIAQLARKNADENLDFIWIDPDEVPTLEDYFEEVFDIDLDDPQIGVVDLDD |
| A0A669DRM9 | 275-347 | DGEHIIAFAEESDPDGFEFLEILKQVAEDNTDNPDLSIVWIDPDDFPLLLPHWEKTFGIDLSHPQIGVVEADD |
| A0A673N0J7 | 139-210 | None |
| A0A183HU23 | 83-146 | None |
| A0A6A4S4G6 | 1026-1097 | None |
| A0A2K5ZPM5 | 1-74 | None |
| A0A553MRE0 | 271-341 | None |
| A0A498NPF4 | 77-149 | None |
| A0A087YEC5 | 271-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.