DPCstruct | MC12324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 78 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0716 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183CY69 | 6-87 | CFGMNVGYPINPARDLGPRLFSLVVYGKEVFTHPYRTWFLVPIIAPMTGAMVFGWAYHICAGMHIPDDEDSEGNDTARDVRT |
| A0A3R7J6M4 | 564-627 | GYAVNPARDFGPRLFTLCAGWGTKTFTSHHYYFWIPIVADLIGGVCGAGLYRILVEIHHPQTPL |
| K3X6K7 | 59-127 | None |
| A0A2P4YNL2 | 1-70 | None |
| A0A662WIB3 | 1-62 | None |
| A0A662WRV8 | 2-83 | None |
| A0A645G520 | 1-87 | None |
| A0A1C7LWF7 | 2-93 | None |
| A0A131YP88 | 34-104 | None |
| A0A132A7M9 | 20-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.