DPCstruct | MC12323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 10.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6M012 | 309-431 | MIYFKGQMKNEKGEPLFPGLTNKIKAALYPPGWFPGVPVRPFFHWFSLVDTAYGVPEPEKPVVRYNPPLKTWLKLYLIGHFTLLLAI… |
| A0A183CXU0 | 1-127 | MLFVKWRTKTAKGEPVFRGIEKLKAIFYPPVYRPGMKVRLYFHWFSMVDHEEGVPPIENVVIRYNPAIPRWQKAYCLGHFLLLLAIF… |
| A0A0B2VZ47 | 1-143 | None |
| A0A0M3IKS0 | 69-199 | None |
| A0A2A6CQC3 | 637-743 | None |
| A0A3P7IJH3 | 31-161 | None |
| A0A6V7Y389 | 3-108 | None |
| A0A183C875 | 470-599 | None |
| A0A6G0V3A7 | 844-964 | None |
| A0A0N4TA60 | 110-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.