DPCstruct | MC12321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183TVN2 | 1-94 | MGIAPPLPDHFVDSLRILFDILDTNRTGHISYQQLCARWDELPTPQLPQSFLDCLGRITPRNGMLTFERFLTAVRQSLNEQNACRVR… |
| A0A183CWX2 | 1-96 | MRPNKAAVNGPLFEHNIESLRTGFQLLDPNRTGFISYKQLCNHWDELPVLGTPKNFLEDLHDMTLPDGTLTYDRFIGAAQSTVNGQL… |
| A0A5F4W4H4 | 12-109 | None |
| A0A3B0JMK4 | 447-548 | None |
| A0A6P6C5V4 | 65-175 | None |
| A0A4Y7LQQ6 | 1-97 | None |
| A0A016TLA5 | 42-156 | None |
| A0A0J7KNJ9 | 2-78 | None |
| A0A7R9FI93 | 118-217 | None |
| A0A0N4XZV0 | 16-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.