DPCstruct | MC12320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 471 ± 72 aa |
| Standard deviation of domain lengths | 72.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3G2K0 | 1-369 | NRDSLVCSILDGVRASGNQCVCVRSTNSRRDLRVQPMAVASSEEVESMHLRFLRQPPEGISFWEMVERFNANVAYSGLVHAVSQDGI… |
| A0A183CWN5 | 52-462 | DLLLTSLVDGARAARNYCVFVMCTKLDRALRLIPYKVVLDEESEGQCMRHIIQPPPGLKRYDLIRRFNANVPYDGLTHPDISEGFFT… |
| A0A7R9ANP8 | 184-607 | None |
| A0A3P7NXS2 | 2-444 | None |
| A1Z7S0 | 307-812 | None |
| A0A7G2CDZ9 | 157-679 | None |
| A0A3F2RWD9 | 2-398 | None |
| A0A0P1AEH4 | 506-895 | None |
| A0A6J0YW09 | 307-816 | None |
| A0A183T130 | 267-862 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.