DPCstruct | MC1232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2Q8U8 | 2-97 | ASHYGRPPCRDDEIAGETPSFFTTIPGAFCARLCDSSRDCPEDVPAGATAEPQCVFQQKNGTGFCALTCGHHKLCPSGARCSIVFFD… |
| A0A090MBU4 | 27-143 | APGPHPHPHPHPHPKPHGAKPYGDPSKGPCLPREQKVQIQGINGDFCSPSCSKASPCPADPYKGALAKPACVLQTPGSDGPDRCALV… |
| A6G1U0 | 119-231 | None |
| A0A812L427 | 610-701 | None |
| A0A7S0GK17 | 42-162 | None |
| A0A7S0LJE3 | 5-123 | None |
| A0A1E7EV14 | 36-169 | None |
| A0A1Q9CV48 | 1081-1187 | None |
| A0A7R9ZJL5 | 112-223 | None |
| K8EE18 | 10-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.