DPCstruct | MC12319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8Q8J7 | 1-125 | MPGMVLFRRRWSVGSDDLVLPAFFLFVLHCIWLVVLSVVLFGLPYSSEQSCSVTLVDHGRGYLGILVSCLICESAIMWLSMRGSILY… |
| A0A183CWN0 | 1-118 | MPSLVVFGRRWNIASDDFVFPSLSEALVRLAWVTTTCIIFMLKKWRSCADQQFLIFIFSLIGVNSVTVLVCFILALASARGSILEPQ… |
| A0A5N5T6V5 | 1-126 | None |
| A0A182MP32 | 21-144 | None |
| A0A2R2MQZ4 | 1-135 | None |
| A0A1B6CRZ8 | 1-122 | None |
| A0A0V1DF00 | 1-118 | None |
| A0A6S7JR12 | 1-144 | None |
| A0A504YG01 | 1-122 | None |
| A0A087SHW4 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.