DPCstruct | MC12318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 245 ± 40 aa |
| Standard deviation of domain lengths | 39.71 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IZL8 | 12-232 | LNLGGEMMYILDQRLQAQKIPKDKSMKVMNDITSIMLNEKFLGELFKPQEVYNKQALRKLFEDLAHGSIMRLNSASMDKLYDLMTMV… |
| A0A183CV96 | 13-214 | FKYYFKAQNVSKEKTIRVLTDILHMMFNTKFLEELFKPQHVYSRRTTRMFFEKLAHSSIMRLNETSMDKLYDLMTMAYKYQLQLCTG… |
| A0A2A3EBN1 | 555-836 | None |
| A0A672KF04 | 18-280 | None |
| A0A672KBX4 | 2-227 | None |
| A0A7S0G710 | 6-278 | None |
| A0A183FP39 | 5-206 | None |
| A4HXK3 | 1-276 | None |
| B7PHA9 | 1-174 | None |
| T1FG64 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.