DPCstruct | MC12317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 137 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q20936 | 349-484 | SADYDVKQCRKGLNGIGVRFQKKFPSYLQKGGKDRELAELVEQRLLECERKSSASHWDKVDTLLQKISLTNSEEGECRAGLIQERIS… |
| A0A183CUI5 | 10-135 | DYRRVSAEFKRKFPLKTAKDVRDKHLAEVVEKRLIDCDQKSKKDYWMNLMKSLPKAKLSASEEEECRNGLVQERIACVNLMSFTCQF… |
| A0A1I7ZTH1 | 714-845 | None |
| A0A5S6PML8 | 135-269 | None |
| A0A0M3INS0 | 44-181 | None |
| A0A811KPM8 | 252-396 | None |
| A0A6V7V6J1 | 1-139 | None |
| A0A6G0UHL4 | 337-468 | None |
| A0A0N4XF32 | 1-124 | None |
| A0A0N4UJR4 | 220-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.