DPCstruct | MC12316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 87 ± 13 aa |
| Standard deviation of domain lengths | 12.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13834 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6ERC3 | 9-72 | SSGDEVADNPSSFDLPGADLSDLELDVVVLPAQQDEFTCMNCFLVKHRSQLDHEGASGPICKEC |
| A0A838KM71 | 1-81 | EDSIEELKARRHDKNSGKVDEDEVEAAESFELPGADLSHEELTVQVLPRQQDEFTCSSCFLVHHRSQLATSKKGVLVCRDC |
| A0A7I8B460 | 31-128 | None |
| A0A1B1KHF9 | 142-243 | None |
| A0A4Y3W0P0 | 1-96 | None |
| A0A538AP61 | 12-102 | None |
| A0A7X9R0Q9 | 1-91 | None |
| A0A810N1E2 | 114-211 | None |
| A0A849DKC7 | 76-173 | None |
| A0A439E0K2 | 74-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.