DPCstruct | MC1231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 212 ± 42 aa |
| Standard deviation of domain lengths | 42.01 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090M5S0 | 24-237 | LFALARGVMPREEDNRRKSTSVSEEVDATPVEGEGAGEPFSVLNASYALAVAASVGYVTKLICAALNVRGMDIPIITLITVILATAL… |
| A0A7S2JTJ9 | 7-154 | ILPPGTSSLPLISILTVVGASTFPKFFSSLRTTGTAIGILFMQMFFAASGAAGSILLVLRSAPSLFLFSVSQIGIHFLTLMGIGKYL… |
| A0A7S1FXY2 | 48-282 | None |
| A0A7S0CBI7 | 3-207 | None |
| A0A7X7MAL3 | 13-180 | None |
| A0A6J1CGH1 | 57-256 | None |
| A0A7R9T5C6 | 54-225 | None |
| A0A192F623 | 5-178 | None |
| D5RB78 | 1-233 | None |
| A0A3D3S9W7 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.