DPCstruct | MC12308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 103 ± 17 aa |
| Standard deviation of domain lengths | 16.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0022- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1TYK2 | 1-102 | MKRVDVFSMQIVAKYFQFITDYLYIIQVCKKYKFLLDRFRINPIRISPKYKPLFTHIQTQIVFTPYDIIVPVDRHIFLYYVSYQEYK… |
| A0A0A1UC92 | 1-98 | MSRLDVYHMMIVSQYFLCLNDFITLEMVKRKFKNNIEKFQFNPIPINKKTIKYFTHIETLNLWSKEDERFGNYIFDKKNFISHQKVN… |
| L7FNH4 | 1-125 | None |
| L7FNZ8 | 2-91 | None |
| M2SD96 | 3-88 | None |
| B0E920 | 1-103 | None |
| B0EQL6 | 1-103 | None |
| B0ELN9 | 312-423 | None |
| B0ERK2 | 1-131 | None |
| M7VW34 | 13-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.