DPCstruct | MC12300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 195 ± 22 aa |
| Standard deviation of domain lengths | 21.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1TVD5 | 2-173 | SANLNRDSQRFIEQRNLQTYLECTILAILSYNTEIQLIKPQKLTKHSQPFIKIKKLMILNDDKWSLEIDTIVKERIKAIEKDYKNSG… |
| A0A0A1UEX9 | 2-170 | VFQQALLIALANQFCGFTIETPTKMAQITETLPNIIKMQAENDLVDVIGLAETQAKQLLQATKHTQISVKEKSLQRRIKKNITYFTQ… |
| N9V1T1 | 3-141 | None |
| B0EIM2 | 1-241 | None |
| C4M440 | 8-220 | None |
| M2SDK3 | 2-221 | None |
| B0E686 | 3-202 | None |
| B0E6P6 | 12-203 | None |
| B0ELT2 | 7-214 | None |
| K2GUX7 | 3-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.