DPCstruct | MC1230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 193 |
|---|---|
| Mean domain length (aa) | 141 ± 22 aa |
| Standard deviation of domain lengths | 21.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | CL0023- PF01288- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S1ZC96 | 1-109 | MKVIVSLGSNKNQIENIEIAEKELKTFFSAIRFSTTQYTGDGYYNAVGVGETALSYDELRLHAKSLEKRLGRTDDRETIPIDVDILE… |
| B9K793 | 2-143 | VIALGSNLGDREMNLKTAIVKMKGRCMYIEKLSSFVETEPYGYTDQPKFLNAVCLVETDLSPRTLLNTLLEIEREMGRVRTVKWGPR… |
| A0A1V8STV2 | 409-570 | None |
| A0A4Y7JJS4 | 462-610 | None |
| A0A1T4JZX0 | 124-268 | None |
| A0A2A2K2E8 | 2-135 | None |
| A0A7C3M7R4 | 6-120 | None |
| B6Y971 | 2-137 | None |
| A0A2E0USE7 | 36-194 | None |
| A0A7Y2NAV7 | 4-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.