DPCstruct | MC123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 17.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517XWR9 | 25-138 | HKKGFEWVADDDGTVYQSTSLSPEAVEVLQQQRERFVATFGREPGPDEPIFFDAPPVEQIEFQMVQAMTAAGIDPAIIYAYEKSGGL… |
| A0A1Q9V068 | 10-123 | PTGRQYSWDAEPETGVQMADVLRRRRALFVETFGREPAPEDPLFFDADAREPRPLEELDFDWDMIFEAFDATGIDPAYAEAWRELGY… |
| A0A495P5K7 | 2-109 | None |
| A0A7Z9WHQ3 | 19-142 | None |
| A0A7K0IBL3 | 18-143 | None |
| A0A6N6T438 | 9-113 | None |
| Q029C8 | 3-101 | None |
| A0A7W4J3J0 | 1-100 | None |
| A0A7W1A0Q6 | 1-97 | None |
| A0A6M8WSH0 | 30-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.