DPCstruct | MC12297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 363 |
|---|---|
| Mean domain length (aa) | 148 ± 22 aa |
| Standard deviation of domain lengths | 21.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.47 |
| Pfam Score | 99.75 |
| Assigned Pfam label(s) | PF18885- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8HW01 | 13-133 | AAKALANHHPLYRSWNGSDHFYTSSKAEYDGLPNKYKREGIACYVATTKIPGHTELYRLYKGKIDDHFYTTSSSEKNKAVSSYGYKY… |
| A0A838UJL8 | 6-110 | VRTEAYVLTEAGEGTLPLKLYWNEAVGDHATVATAEGERDALAGGYAFEGSQGFVYAEPRPGTVPLKQFWNAANRRSLLTATPKEEA… |
| A0A6N9RBR7 | 42-219 | None |
| A0A1D7QL67 | 44-199 | None |
| K9Z2U8 | 301-466 | None |
| K9Z2R5 | 580-751 | None |
| R2T0Z4 | 17-165 | None |
| R9LPU2 | 342-478 | None |
| R9LLN0 | 2-112 | None |
| D8LKG0 | 297-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.