DPCstruct | MC12295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 662 |
|---|---|
| Mean domain length (aa) | 116 ± 25 aa |
| Standard deviation of domain lengths | 24.93 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.10 |
| Pfam Score | 90.36 |
| Assigned Pfam label(s) | CL0123- CL0291- CL0260- PF13427 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6CZP8 | 6-112 | EKTAREFAAEAVEALGEHIYSIVLYGSVVRGEASDESDIDVLVIGDGQSGAEDRVLDISYEIDLRNRTATSIFYSTPEDFERRLKLG… |
| A0A7H4NWG1 | 209-390 | TWLAEAMIDAVVQQAWLQMVARYGQPTHLHERQGRGFAVVGYGKLGGWELGYSSDLDLVFLHDCPMEVMTDGEREIDGRQFYLRLAQ… |
| A0A357T657 | 14-121 | None |
| A0A1G6JC53 | 1-114 | None |
| A0A250KYF8 | 217-360 | None |
| A0A1V4WNF8 | 152-269 | None |
| A0A847PFE3 | 14-140 | None |
| A0A2A7D1W8 | 5-85 | None |
| M0D1F5 | 38-152 | None |
| A0A7C7QTK8 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.