DPCstruct | MC12294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 99 ± 14 aa |
| Standard deviation of domain lengths | 13.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6CYU1 | 19-91 | VCLVHDPRPTSPVGKTFTVEFLGNVIGGGIVQYLNVDIDLMKQIAMRKIVDGEPVWMGCDVGKMMQRKLGLWD |
| A0A4Z2H2V2 | 36-128 | LTPRDFYQEHVKPLYNIHDKVCLVNDPRPQNPYAKLYSVEFLGNMVGGRPTQYNNQAIQLLKKAAADSIKDGEAVWFGCDVGKHFHG… |
| A0A5Q5FYY0 | 2-85 | None |
| A9UPL3 | 236-343 | None |
| A0A7R8CRY9 | 151-256 | None |
| X6PD93 | 133-232 | None |
| A0A0W4ZEP7 | 275-391 | None |
| A0A6F9CGG2 | 195-301 | None |
| A0A1J8QMG4 | 41-125 | None |
| H3C8X2 | 5-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.