DPCstruct | MC12293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 291 ± 46 aa |
| Standard deviation of domain lengths | 45.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318BNK1 | 2-233 | LLLAALAVPFVIGATLSGVAASTMLLIVAVAGAYLLFWIGLAGLVSRLSHGSTANAATLAGAWLVFVLVLPTLANVVINRAIPVDEG… |
| A0A1F6CJ20 | 59-368 | VCGEKEAGTLRLLASFSVPRDRLLMGKLIGALIPTLTVFGLSLTLGIAGVFAMPDIQFTGSELARLGWTLVACGLYLTAFTCIGIFA… |
| A0A1Q3W840 | 2-204 | None |
| A0A7X3L241 | 190-521 | None |
| A0A497PNK7 | 49-411 | None |
| A0A2H5VWL1 | 68-457 | None |
| A0A1E3Y2Y6 | 3-270 | None |
| A0A0E3BRN8 | 39-344 | None |
| A0A7X3NYT1 | 3-343 | None |
| A0A516GVH9 | 148-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.