DPCstruct | MC12291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 164 ± 31 aa |
| Standard deviation of domain lengths | 31.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0292 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150N7E0 | 114-297 | AKRLLAAQVIFVFLINEEIVFRYEPTVKQFYAEKQFQEIKEYIGLPVADYRVVSIGIYPAIAQYNGFYTLDTYNNFYPLSYKYEFRK… |
| R5CEV0 | 24-207 | AMIPAALFLLCAAALCILAGDSAQIGIADNLDLFQAQYQMLKNTKTFFAQGAAAYGFHPAVLEYNGISTVDGYLGFYSQSYKEEFRR… |
| A0A416P2J4 | 151-351 | None |
| A0A1N7JFQ2 | 132-269 | None |
| A0A354ID67 | 80-272 | None |
| A0A7Y1U9L0 | 219-410 | None |
| A0A520PQ03 | 1-113 | None |
| A0A3D2EEY3 | 427-575 | None |
| A0A1W9PQB4 | 465-618 | None |
| A0A853IJ06 | 31-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.