DPCstruct | MC12290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 209 ± 21 aa |
| Standard deviation of domain lengths | 20.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1SZE7 | 1-158 | MAMEEGPRANGWYNESIAEPALRSLKTGENISDEYKEKIKDRLEYFANHPAYTVDFYRQKLTTTWAESTYSAIFNNGITEESNLSWV… |
| R5CDM6 | 44-249 | RDISSGLSPWSWVTMGLQENSERYDGWYNGYGLNTYSEANSSGERQKLIAQEDLAERVQFFRDHPMYALSFFSGKNASQWNNPDFQS… |
| A0A645G5L8 | 10-191 | None |
| A0A5P0ZUU1 | 3-230 | None |
| A0A1C5RX01 | 292-518 | None |
| A0A1E3UDP9 | 1-211 | None |
| A0A842JJU2 | 29-233 | None |
| A0A829GJL0 | 119-313 | None |
| A0A354CPP4 | 131-346 | None |
| A0A829TCR4 | 10-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.