DPCstruct | MC1229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.58 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0193- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1ITV6 | 41-125 | VMYGYDFKDYVPGLNAMVKYVYGHDFKAANGEKNHETESNVILNYAFQQPFLKGVALQYIRIDYNVKHGNDFGEDRLFVNYTKKF |
| A0A379L5E3 | 8-87 | FTSMGIPGLSFMTRYYKGEDGVYRGQEAREHESNTNLKYVIQDGLFKGVGAEFRYAVARSTYSSDRDNYRLYLTYDIALW |
| A0A2K4FTK6 | 5-85 | None |
| A0A7W2GD11 | 119-207 | None |
| A0A7L9GAZ1 | 1010-1087 | None |
| A0A3M5VTC9 | 190-279 | None |
| A0A2A2KCE1 | 8-87 | None |
| A4VPG2 | 1002-1083 | None |
| A0A7Y5AAU9 | 128-209 | None |
| A0A3D4NTG0 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.