DPCstruct | MC12289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 22.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1WCQ1 | 57-131 | ENFTPKSFGLDNLADLKSYVITEDDGVVKHSLLLKDGGTYELIYNTDGTFVKSSGTKVSMSLSVDGIATLSMQKP |
| A0A346MYW8 | 5-76 | TIKSVGIENIGDVKEHSINNQFGFVSHFVRFTNGGELEFAYNAQGQIVKFEARNLQTVVQNGERLMFRVSSK |
| A0A643FZ02 | 2-82 | None |
| A0A4Z0C200 | 1-87 | None |
| A0A0T9RQ66 | 36-111 | None |
| A0A520CSI1 | 95-164 | None |
| A0A5Q0MC33 | 18-93 | None |
| A0A520C9J3 | 101-173 | None |
| A0A7W5Y418 | 2-73 | None |
| A0A2V5A8D7 | 75-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.